PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00055545001
Common NameGSBRNA2T00055545001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 428aa    MW: 46956.4 Da    PI: 8.7794
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00055545001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.2e-39105165262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrk+k+ss
  GSBRNA2T00055545001 105 PTKILPCPRCKSMDTKFCYYNNYNINQPRHFCKACQRYWTAGGTMRNVPVGAGRRKHKSSS 165
                          67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3181162IPR003851Zinc finger, Dof-type
PfamPF027016.1E-32107163IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.435109163IPR003851Zinc finger, Dof-type
PROSITE patternPS013610111147IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MMMESRDPAI KLFGMKIPFP AVFEPTTAVA LEEDYSGGDD TSPEKVTTEQ ATPEKKNNCN  60
NKSLNNSNDS KPETGDKEEA TSTDQIESDE TNQQTTADGK TLKKPTKILP CPRCKSMDTK  120
FCYYNNYNIN QPRHFCKACQ RYWTAGGTMR NVPVGAGRRK HKSSSSQYRH ITISEALQAA  180
RLDPGLQANT RVLSFGLQAP HQQHAAPMTP VMKLQGDQKV SNGARNARVE NGDDCSSGSS  240
VTTSVDETRA QSCRVVEPQV NNNNMNGYAC IPGVPWPYTW NPAMPPPGFY PPPGYPMPFY  300
PYWTIPMAPP NQSSSPMSQK GSSPNSPTLG KHYRDEDSST ERKQRNGCVI VPKTLRIDDP  360
NEAAKSSIWT TLGIKNEGST LGSKGGGMFK GFDQKTNKSN KDQTNNSHVL SANPAALSRS  420
LNFQERV*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.46210.0flower| leaf| root| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU4513120.0GU451312.1 Brassica napus putative dof zinc finger protein (dof1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149907.10.0PREDICTED: cyclic dof factor 3
SwissprotQ8LFV30.0CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A078JMT10.0A0A078JMT1_BRANA; BnaAnng22720D protein
TrEMBLM4DNQ40.0M4DNQ4_BRARP; Uncharacterized protein
STRINGBra018141.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.10.0cycling DOF factor 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]